Lineage for d1zioa1 (1zio A:1-125,A:161-217)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829352Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 829357Protein Adenylate kinase [52554] (14 species)
  7. 829375Species Bacillus stearothermophilus [TaxId:1422] [52562] (3 PDB entries)
    contains a zinc-finger subdomain, residues 126-160
  8. 829378Domain d1zioa1: 1zio A:1-125,A:161-217 [31917]
    Other proteins in same PDB: d1zioa2
    complexed with ap5, mg, zn

Details for d1zioa1

PDB Entry: 1zio (more details), 1.96 Å

PDB Description: phosphotransferase
PDB Compounds: (A:) adenylate kinase

SCOP Domain Sequences for d1zioa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zioa1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}
mnlvlmglpgagkgtqaekivaaygiphistgdmfraamkegtplglqakqymdrgdlvp
devtigivrerlskddcqngflldgfprtvaqaealetmladigrkldyvihidvrqdvl
merltXaddneatvanrlevnmkqmkplvdfyeqkgylrningeqdmekvfadirellgg
lar

SCOP Domain Coordinates for d1zioa1:

Click to download the PDB-style file with coordinates for d1zioa1.
(The format of our PDB-style files is described here.)

Timeline for d1zioa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zioa2