Lineage for d4ze5a_ (4ze5 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (97 species)
    not a true protein
  7. 2419125Species Geobacillus stearothermophilus [TaxId:1422] [319127] (16 PDB entries)
  8. 2419150Domain d4ze5a_: 4ze5 A: [319165]
    automated match to d1pbga_
    complexed with gol, imd; mutant

Details for d4ze5a_

PDB Entry: 4ze5 (more details), 1.48 Å

PDB Description: structure of gan1d-e170q, a catalytic mutant of a putative 6-phospho- beta-galactosidase from geobacillus stearothermophilus
PDB Compounds: (A:) Putative 6-phospho-beta-galactobiosidase

SCOPe Domain Sequences for d4ze5a_:

Sequence, based on SEQRES records: (download)

>d4ze5a_ c.1.8.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqnifisfgyrlglh
ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
tvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwaidpvglriglr
rianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgyca
wsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrvietngael

Sequence, based on observed residues (ATOM records): (download)

>d4ze5a_ c.1.8.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlnqqnifisfgyrlglh
ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
tvehnppdgvssgipglfktvrnphvdttnwdwaidpvglriglrrianryqlpiliten
glgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgycawsftdllswlngyqk
rygfvyvnrddesekdlrrikkksfywyqrvietngael

SCOPe Domain Coordinates for d4ze5a_:

Click to download the PDB-style file with coordinates for d4ze5a_.
(The format of our PDB-style files is described here.)

Timeline for d4ze5a_: