SCOPe 2.02: Domain d1zipa1: 1zip A:1-125,A:161-217

Lineage for d1zipa1 (1zip A:1-125,A:161-217)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Adenylate kinase [52554] (15 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [52562] (3 PDB entries)
   contains a zinc-finger subdomain, residues 126-160

8. Domain d1zipa1: 1zip A:1-125,A:161-217 [31916]
   Other proteins in same PDB: d1zipa2
   complexed with ap5, mn, zn

Details for d1zipa1

PDB Entry: 1zip, 1.85 Å

PDB Description: bacillus stearothermophilus adenylate kinase

PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d1zipa1:

Sequence; same for both SEQRES and ATOM records:

>d1zipa1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}
mnlvlmglpgagkgtqaekivaaygiphistgdmfraamkegtplglqakqymdrgdlvp
devtigivrerlskddcqngflldgfprtvaqaealetmladigrkldyvihidvrqdvl
merltXaddneatvanrlevnmkqmkplvdfyeqkgylrningeqdmekvfadirellgg
lar

Timeline for d1zipa1:

• d1zipa1 first appeared (with stable ids) in SCOP 1.55, called d1zip_1
  
• d1zipa1 appears in SCOPe 2.01
  
• d1zipa1 appears in SCOPe 2.03
  
• d1zipa1 appears in the current release, SCOPe 2.08