Lineage for d1zip_1 (1zip 1-125,161-217)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 22944Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (8 proteins)
  6. 22945Protein Adenylate kinase [52554] (8 species)
  7. 22946Species Bacillus stearothermophilus [TaxId:1422] [52562] (3 PDB entries)
  8. 22948Domain d1zip_1: 1zip 1-125,161-217 [31916]
    Other proteins in same PDB: d1zip_2

Details for d1zip_1

PDB Entry: 1zip (more details), 1.85 Å

PDB Description: bacillus stearothermophilus adenylate kinase

SCOP Domain Sequences for d1zip_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zip_1 c.37.1.1 (1-125,161-217) Adenylate kinase {Bacillus stearothermophilus}
mnlvlmglpgagkgtqaekivaaygiphistgdmfraamkegtplglqakqymdrgdlvp
devtigivrerlskddcqngflldgfprtvaqaealetmladigrkldyvihidvrqdvl
merltXaddneatvanrlevnmkqmkplvdfyeqkgylrningeqdmekvfadirellgg
lar

SCOP Domain Coordinates for d1zip_1:

Click to download the PDB-style file with coordinates for d1zip_1.
(The format of our PDB-style files is described here.)

Timeline for d1zip_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zip_2