Class a: All alpha proteins [46456] (289 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) |
Family a.102.1.0: automated matches [191318] (1 protein) not a true family |
Protein automated matches [190108] (21 species) not a true protein |
Species Perinereis brevicirris [TaxId:6356] [319158] (2 PDB entries) |
Domain d4zg8a_: 4zg8 A: [319159] automated match to d1ia6a_ complexed with btb, ca, cl, na |
PDB Entry: 4zg8 (more details), 1.39 Å
SCOPe Domain Sequences for d4zg8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zg8a_ a.102.1.0 (A:) automated matches {Perinereis brevicirris [TaxId: 6356]} aqynyrevlqksilfyaaqrsgqlpgnnpidwrddsalddqgnggedltggwydagdhvk fglpmawtattliwgmidlangyggdrndamqsvrwaldyfmkchvsdnelygqvgdgha dhaywgrpeemtmdrpawsltpsapgsdlagetaaalaagsilfsdsdasyanqlldhar tiydfaynnrgiysesipnaadfyrssayedelcwgalwlyratgeqdymdkaneflpqg rpwafswdskeagslvlltsfgnsnaraqledflqswfpggdihytplglawrdtwgslr ysansafiallaaeegvltsqartfaraqldymlgstgrsfvvgfgtnpplrphhraasc pdmpascgwdqasdpapnpqvldgalvggpddqdnynddrqdyisnevacdynagfqgal agilql
Timeline for d4zg8a_: