Lineage for d4zg8a_ (4zg8 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330024Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2330025Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2330252Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2330253Protein automated matches [190108] (17 species)
    not a true protein
  7. 2330286Species Perinereis brevicirris [TaxId:6356] [319158] (2 PDB entries)
  8. 2330289Domain d4zg8a_: 4zg8 A: [319159]
    automated match to d1ia6a_
    complexed with btb, ca, cl, na

Details for d4zg8a_

PDB Entry: 4zg8 (more details), 1.39 Å

PDB Description: crystal structure of endoglucanase from perinereis brevicirris
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d4zg8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zg8a_ a.102.1.0 (A:) automated matches {Perinereis brevicirris [TaxId: 6356]}
aqynyrevlqksilfyaaqrsgqlpgnnpidwrddsalddqgnggedltggwydagdhvk
fglpmawtattliwgmidlangyggdrndamqsvrwaldyfmkchvsdnelygqvgdgha
dhaywgrpeemtmdrpawsltpsapgsdlagetaaalaagsilfsdsdasyanqlldhar
tiydfaynnrgiysesipnaadfyrssayedelcwgalwlyratgeqdymdkaneflpqg
rpwafswdskeagslvlltsfgnsnaraqledflqswfpggdihytplglawrdtwgslr
ysansafiallaaeegvltsqartfaraqldymlgstgrsfvvgfgtnpplrphhraasc
pdmpascgwdqasdpapnpqvldgalvggpddqdnynddrqdyisnevacdynagfqgal
agilql

SCOPe Domain Coordinates for d4zg8a_:

Click to download the PDB-style file with coordinates for d4zg8a_.
(The format of our PDB-style files is described here.)

Timeline for d4zg8a_: