Lineage for d4zk6b_ (4zk6 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2530790Fold c.145: NadA-like [142753] (1 superfamily)
    duplication; consists of three similar domains related by pseudo threefold symmetry; 3 layers, a/b/a; parallel beta sheet, order: 2134
  4. 2530791Superfamily c.145.1: NadA-like [142754] (2 families) (S)
    automatically mapped to Pfam PF02445
  5. 2530792Family c.145.1.1: NadA-like [142755] (1 protein)
    Pfam PF02445
  6. 2530793Protein Quinolinate synthetase A, NadA [142756] (2 species)
  7. 2530796Species Pyrococcus horikoshii [TaxId:70601] [319156] (12 PDB entries)
  8. 2530807Domain d4zk6b_: 4zk6 B: [319157]
    automated match to d1wzua1
    complexed with act, cl, na, ntm, sf4

Details for d4zk6b_

PDB Entry: 4zk6 (more details), 1.9 Å

PDB Description: crystallographic capture of quinolinate synthase (nada) from pyrococcus horikoshii in its substrates and product-bound states
PDB Compounds: (B:) Quinolinate synthase A

SCOPe Domain Sequences for d4zk6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zk6b_ c.145.1.1 (B:) Quinolinate synthetase A, NadA {Pyrococcus horikoshii [TaxId: 70601]}
dlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdfm
aetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaeakayad
vtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkftlddv
erakklhpnaklmihpecipevqekadiiastggmikracewdewvvfteremvyrlrkl
ypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaiermlems

SCOPe Domain Coordinates for d4zk6b_:

Click to download the PDB-style file with coordinates for d4zk6b_.
(The format of our PDB-style files is described here.)

Timeline for d4zk6b_: