Lineage for d4zkae_ (4zka E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952339Protein automated matches [190332] (5 species)
    not a true protein
  7. 2952350Species Human (Homo sapiens) [TaxId:9606] [187155] (29 PDB entries)
  8. 2952391Domain d4zkae_: 4zka E: [319155]
    automated match to d2erra1
    complexed with mes, pg4, so4

Details for d4zkae_

PDB Entry: 4zka (more details), 1.8 Å

PDB Description: high resolution crystal structure of fox1 rrm
PDB Compounds: (E:) RNA binding protein fox-1 homolog 1

SCOPe Domain Sequences for d4zkae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zkae_ d.58.7.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksqpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfensadadra
reklhgtvvegrkievnnat

SCOPe Domain Coordinates for d4zkae_:

Click to download the PDB-style file with coordinates for d4zkae_.
(The format of our PDB-style files is described here.)

Timeline for d4zkae_: