| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein automated matches [226848] (11 species) not a true protein |
| Species Arabidopsis thaliana [TaxId:3702] [318877] (4 PDB entries) |
| Domain d5a5kq2: 5a5k Q:87-212 [319150] Other proteins in same PDB: d5a5ka1, d5a5kb1, d5a5kc1, d5a5kd1, d5a5ke1, d5a5kf1, d5a5kg1, d5a5kh1, d5a5ki1, d5a5kj1, d5a5kk1, d5a5kl1, d5a5km1, d5a5kn1, d5a5ko1, d5a5kp1, d5a5kq1, d5a5kr1, d5a5ks1, d5a5kt1, d5a5ku1, d5a5kv1, d5a5kw1, d5a5kx1 automated match to d1gnwa1 complexed with 7wb |
PDB Entry: 5a5k (more details), 2.77 Å
SCOPe Domain Sequences for d5a5kq2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a5kq2 a.45.1.1 (Q:87-212) automated matches {Arabidopsis thaliana [TaxId: 3702]}
lqtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklak
vldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrp
asekvq
Timeline for d5a5kq2:
View in 3DDomains from other chains: (mouse over for more information) d5a5ka1, d5a5ka2, d5a5kb1, d5a5kb2, d5a5kc1, d5a5kc2, d5a5kd1, d5a5kd2, d5a5ke1, d5a5ke2, d5a5kf1, d5a5kf2, d5a5kg1, d5a5kg2, d5a5kh1, d5a5kh2, d5a5ki1, d5a5ki2, d5a5kj1, d5a5kj2, d5a5kk1, d5a5kk2, d5a5kl1, d5a5kl2, d5a5km1, d5a5km2, d5a5kn1, d5a5kn2, d5a5ko1, d5a5ko2, d5a5kp1, d5a5kp2, d5a5kr1, d5a5kr2, d5a5ks1, d5a5ks2, d5a5kt1, d5a5kt2, d5a5ku1, d5a5ku2, d5a5kv1, d5a5kv2, d5a5kw1, d5a5kw2, d5a5kx1, d5a5kx2 |