Lineage for d2n8za1 (2n8z A:743-892)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2320807Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2320808Protein automated matches [190513] (31 species)
    not a true protein
  7. 2320858Species Human (Homo sapiens) [TaxId:9606] [189519] (52 PDB entries)
  8. 2320911Domain d2n8za1: 2n8z A:743-892 [319147]
    Other proteins in same PDB: d2n8za2
    automated match to d3gn4f_

Details for d2n8za1

PDB Entry: 2n8z (more details)

PDB Description: apo form of calmodulin-like domain of human non-muscle alpha-actinin 1
PDB Compounds: (A:) Alpha-actinin-1

SCOPe Domain Sequences for d2n8za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n8za1 a.39.1.0 (A:743-892) automated matches {Human (Homo sapiens) [TaxId: 9606]}
isqeqmnefrasfnhfdrdhsgtlgpeefkaclislgydigndpqgeaefarimsivdpn
rlgvvtfqafidfmsretadtdtadqvmasfkilagdknyitmdelrrelppdqaeycia
rmapytgpdsvpgaldymsfstalygesdl

SCOPe Domain Coordinates for d2n8za1:

Click to download the PDB-style file with coordinates for d2n8za1.
(The format of our PDB-style files is described here.)

Timeline for d2n8za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2n8za2