| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
| Protein automated matches [190531] (23 species) not a true protein |
| Species Phormidium rubidum [TaxId:865859] [272704] (5 PDB entries) |
| Domain d5aqdd_: 5aqd D: [319141] automated match to d1eyxa_ complexed with gol, peb, so4 |
PDB Entry: 5aqd (more details), 2.12 Å
SCOPe Domain Sequences for d5aqdd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aqdd_ a.1.1.3 (D:) automated matches {Phormidium rubidum [TaxId: 865859]}
mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
Timeline for d5aqdd_: