SCOP 1.61: Domain d1zakb1: 1zak B:3-127,B:159-222

Lineage for d1zakb1 (1zak B:3-127,B:159-222)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families)

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins)

6. Protein Adenylate kinase [52554] (8 species)

7. Species Maize (Zea mays) [TaxId:4577] [52561] (1 PDB entry)

8. Domain d1zakb1: 1zak B:3-127,B:159-222 [31914]
   Other proteins in same PDB: d1zaka2, d1zakb2

Details for d1zakb1

PDB Entry: 1zak, 3.5 Å

PDB Description: adenylate kinase from maize in complex with the inhibitor p1,p5-bis(adenosine-5'-)pentaphosphate (ap5a)

SCOP Domain Sequences for d1zakb1:

Sequence; same for both SEQRES and ATOM records:

>d1zakb1 c.37.1.1 (B:3-127,B:159-222) Adenylate kinase {Maize (Zea mays)}
adplkvmisgapasgkgtqceliktkyqlahisagdllraeiaagsengkrakefmekgq
lvpdeivvnmvkerlrqpdaqengwlldgyprsysqamaletleirpdtfilldvpdell
vervvXfddteekvklrletyyqniesllstyeniivkvqgdatvdavfakidellgsil
ekknemvsst

Timeline for d1zakb1:

• d1zakb1 first appeared (with stable ids) in SCOP 1.55
  
• d1zakb1 appears in SCOP 1.59
  
• d1zakb1 appears in SCOP 1.63
  
• d1zakb1 appears in the current release, SCOPe 2.08