![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) ![]() |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins) |
![]() | Protein Adenylate kinase [52554] (8 species) |
![]() | Species Maize (Zea mays) [TaxId:4577] [52561] (1 PDB entry) |
![]() | Domain d1zakb1: 1zak B:3-127,B:159-222 [31914] Other proteins in same PDB: d1zaka2, d1zakb2 |
PDB Entry: 1zak (more details), 3.5 Å
SCOP Domain Sequences for d1zakb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zakb1 c.37.1.1 (B:3-127,B:159-222) Adenylate kinase {Maize (Zea mays)} adplkvmisgapasgkgtqceliktkyqlahisagdllraeiaagsengkrakefmekgq lvpdeivvnmvkerlrqpdaqengwlldgyprsysqamaletleirpdtfilldvpdell vervvXfddteekvklrletyyqniesllstyeniivkvqgdatvdavfakidellgsil ekknemvsst
Timeline for d1zakb1: