Lineage for d4zefa1 (4zef A:252-483)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2522886Species Enterococcus faecalis [TaxId:226185] [195543] (5 PDB entries)
  8. 2522888Domain d4zefa1: 4zef A:252-483 [319136]
    Other proteins in same PDB: d4zefa2
    automated match to d4kqpa_
    complexed with gln

Details for d4zefa1

PDB Entry: 4zef (more details), 1.4 Å

PDB Description: crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
PDB Compounds: (A:) Amino acid ABC transporter amino acid-binding/permease

SCOPe Domain Sequences for d4zefa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zefa1 c.94.1.0 (A:252-483) automated matches {Enterococcus faecalis [TaxId: 226185]}
mkkitpkkekyviasdstfapfefqnaqgdyvgidvdlvkraaelqgftvefkfigfssa
vqavesgqadgmvagmtitddrkkafdfsvpyfdsgiqiavkkgndkiksyddlkgkkvg
vkigtesadfleknkkkydysikyldttdalysaleigevdammddypvigygvaqnqpl
atpiprekggsygfavkkgqnpellemfneglkemkrtgeydkiigtyvkdg

SCOPe Domain Coordinates for d4zefa1:

Click to download the PDB-style file with coordinates for d4zefa1.
(The format of our PDB-style files is described here.)

Timeline for d4zefa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zefa2