Lineage for d1zaka1 (1zak A:3-127,A:159-222)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121669Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (12 proteins)
  6. 121670Protein Adenylate kinase [52554] (8 species)
  7. 121707Species Maize (Zea mays) [TaxId:4577] [52561] (1 PDB entry)
  8. 121708Domain d1zaka1: 1zak A:3-127,A:159-222 [31913]
    Other proteins in same PDB: d1zaka2, d1zakb2

Details for d1zaka1

PDB Entry: 1zak (more details), 3.5 Å

PDB Description: adenylate kinase from maize in complex with the inhibitor p1,p5-bis(adenosine-5'-)pentaphosphate (ap5a)

SCOP Domain Sequences for d1zaka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays)}
adplkvmisgapasgkgtqceliktkyqlahisagdllraeiaagsengkrakefmekgq
lvpdeivvnmvkerlrqpdaqengwlldgyprsysqamaletleirpdtfilldvpdell
vervvXfddteekvklrletyyqniesllstyeniivkvqgdatvdavfakidellgsil
ekknemvsst

SCOP Domain Coordinates for d1zaka1:

Click to download the PDB-style file with coordinates for d1zaka1.
(The format of our PDB-style files is described here.)

Timeline for d1zaka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zaka2