SCOP 1.61: Domain d2eckb1: 2eck B:1-121,B:157-214

Lineage for d2eckb1 (2eck B:1-121,B:157-214)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families)

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins)

6. Protein Adenylate kinase [52554] (8 species)

7. Species Escherichia coli [TaxId:562] [52560] (6 PDB entries)

8. Domain d2eckb1: 2eck B:1-121,B:157-214 [31912]
   Other proteins in same PDB: d2ecka2, d2eckb2

Details for d2eckb1

PDB Entry: 2eck, 2.8 Å

PDB Description: structure of phosphotransferase

SCOP Domain Sequences for d2eckb1:

Sequence; same for both SEQRES and ATOM records:

>d2eckb1 c.37.1.1 (B:1-121,B:157-214) Adenylate kinase {Escherichia coli}
mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg

Timeline for d2eckb1:

• d2eckb1 first appeared (with stable ids) in SCOP 1.55
  
• d2eckb1 appears in SCOP 1.59
  
• d2eckb1 appears in SCOP 1.63
  
• d2eckb1 appears in the current release, SCOPe 2.08