Lineage for d2ecka1 (2eck A:1-121,A:157-214)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829352Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 829357Protein Adenylate kinase [52554] (14 species)
  7. 829393Species Escherichia coli [TaxId:562] [52560] (6 PDB entries)
    contains a rudiment "zinc-finger" subdomain, residue 122-156
  8. 829404Domain d2ecka1: 2eck A:1-121,A:157-214 [31911]
    Other proteins in same PDB: d2ecka2, d2eckb2

Details for d2ecka1

PDB Entry: 2eck (more details), 2.8 Å

PDB Description: structure of phosphotransferase
PDB Compounds: (A:) adenylate kinase

SCOP Domain Sequences for d2ecka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ecka1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}
mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg

SCOP Domain Coordinates for d2ecka1:

Click to download the PDB-style file with coordinates for d2ecka1.
(The format of our PDB-style files is described here.)

Timeline for d2ecka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ecka2