| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein automated matches [227019] (3 species) not a true protein |
| Species Arabidopsis thaliana [TaxId:3702] [318873] (4 PDB entries) |
| Domain d5a4va1: 5a4v A:2-86 [319096] Other proteins in same PDB: d5a4va2, d5a4vb2, d5a4vc2, d5a4vd2, d5a4ve2, d5a4vf2 automated match to d1gnwa2 complexed with act, que |
PDB Entry: 5a4v (more details), 2.38 Å
SCOPe Domain Sequences for d5a4va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a4va1 c.47.1.5 (A:2-86) automated matches {Arabidopsis thaliana [TaxId: 3702]}
agikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedg
dlklfesraitqyiahryenqgtnl
Timeline for d5a4va1: