![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) ![]() |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins) |
![]() | Protein Adenylate kinase [52554] (8 species) |
![]() | Species Escherichia coli [TaxId:562] [52560] (6 PDB entries) |
![]() | Domain d4akea1: 4ake A:1-121,A:157-214 [31909] Other proteins in same PDB: d4akea2, d4akeb2 |
PDB Entry: 4ake (more details), 2.2 Å
SCOP Domain Sequences for d4akea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4akea1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli} mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg
Timeline for d4akea1: