SCOPe 2.08: Domain d5jq4a1: 5jq4 A:1-141

Lineage for d5jq4a1 (5jq4 A:1-141)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [319077] (2 PDB entries)

8. Domain d5jq4a1: 5jq4 A:1-141 [319082]
   Other proteins in same PDB: d5jq4a2, d5jq4b2
   automated match to d1q2ya_
   complexed with cl, edo, scn, unx

Details for d5jq4a1

PDB Entry: 5jq4, 1.8 Å

PDB Description: structure of a gnat acetyltransferase sacol1063 from staphylococcus aureus

PDB Compounds: (A:) Acetyltransferase SACOL1063

SCOPe Domain Sequences for d5jq4a1:

Sequence; same for both SEQRES and ATOM records:

>d5jq4a1 d.108.1.0 (A:1-141) automated matches {Staphylococcus aureus [TaxId: 93062]}
mfskvnnqkmledcfyirkkvfveeqgipeeseideyesesihligydngqpvatarirp
inettvkiervavmkshrgqgmgrmlmqaveslakdegfyvatmnaqchaipfyeslnfk
mrgnifleegiehiemtkklt

Timeline for d5jq4a1:

• d5jq4a1 first appeared in SCOPe 2.06
  
• d5jq4a1 appears in SCOPe 2.07