Lineage for d1ankb1 (1ank B:1-121,B:157-214)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 22944Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (8 proteins)
  6. 22945Protein Adenylate kinase [52554] (8 species)
  7. 22962Species Escherichia coli [TaxId:562] [52560] (6 PDB entries)
  8. 22970Domain d1ankb1: 1ank B:1-121,B:157-214 [31908]
    Other proteins in same PDB: d1anka2, d1ankb2

Details for d1ankb1

PDB Entry: 1ank (more details), 2 Å

PDB Description: the closed conformation of a highly flexible protein: the structure of e. coli adenylate kinase with bound amp and amppnp

SCOP Domain Sequences for d1ankb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ankb1 c.37.1.1 (B:1-121,B:157-214) Adenylate kinase {Escherichia coli}
mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg

SCOP Domain Coordinates for d1ankb1:

Click to download the PDB-style file with coordinates for d1ankb1.
(The format of our PDB-style files is described here.)

Timeline for d1ankb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ankb2