Lineage for d1ankb1 (1ank B:1-121,B:157-214)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2865690Protein Adenylate kinase [52554] (16 species)
  7. 2865714Species Escherichia coli [TaxId:562] [52560] (10 PDB entries)
    contains a rudiment "zinc-finger" subdomain, residue 122-156
  8. 2865727Domain d1ankb1: 1ank B:1-121,B:157-214 [31908]
    Other proteins in same PDB: d1anka2, d1ankb2
    complexed with amp, anp

Details for d1ankb1

PDB Entry: 1ank (more details), 2 Å

PDB Description: the closed conformation of a highly flexible protein: the structure of e. coli adenylate kinase with bound amp and amppnp
PDB Compounds: (B:) adenylate kinase

SCOPe Domain Sequences for d1ankb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ankb1 c.37.1.1 (B:1-121,B:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}
mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg

SCOPe Domain Coordinates for d1ankb1:

Click to download the PDB-style file with coordinates for d1ankb1.
(The format of our PDB-style files is described here.)

Timeline for d1ankb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ankb2