![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (6 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226565] (83 PDB entries) |
![]() | Domain d5jh7d2: 5jh7 D:246-441 [319074] Other proteins in same PDB: d5jh7a1, d5jh7b1, d5jh7c1, d5jh7d1, d5jh7e_, d5jh7f1, d5jh7f2, d5jh7f3 automated match to d3rycd2 complexed with 03s, 6k9, acp, ca, gdp, gol, gtp, imd, mes, mg |
PDB Entry: 5jh7 (more details), 2.25 Å
SCOPe Domain Sequences for d5jh7d2:
Sequence, based on SEQRES records: (download)
>d5jh7d2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqdatad
>d5jh7d2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltraltvpeltqqmfdsknmmaacdprhgry ltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfign staiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdata d
Timeline for d5jh7d2: