SCOPe 2.08: Domain d5iwla1: 5iwl A:1-122

Lineage for d5iwla1 (5iwl A:1-122)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5iwla1: 5iwl A:1-122 [319066]
   Other proteins in same PDB: d5iwla2, d5iwlb2
   automated match to d1svza2
   complexed with nag, pge

Details for d5iwla1

PDB Entry: 5iwl, 2.8 Å

PDB Description: cd47-diabody complex

PDB Compounds: (A:) 5F9 diabody

SCOPe Domain Sequences for d5iwla1:

Sequence; same for both SEQRES and ATOM records:

>d5iwla1 b.1.1.0 (A:1-122) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgasvkvsckasgytftnynmhwvrqapgqrlewmgtiypgnddtsy
nqkfkdrvtitadtsastaymelsslrsedtavyycarggyramdywgqgtlvtvssggs
gg

Timeline for d5iwla1:

• d5iwla1 first appeared in SCOPe 2.06
  
• d5iwla1 appears in SCOPe 2.07