Lineage for d5iwla1 (5iwl A:1-122)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (29 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2357261Domain d5iwla1: 5iwl A:1-122 [319066]
    Other proteins in same PDB: d5iwla2, d5iwlb2
    automated match to d1svza2
    complexed with nag, pge

Details for d5iwla1

PDB Entry: 5iwl (more details), 2.8 Å

PDB Description: cd47-diabody complex
PDB Compounds: (A:) 5F9 diabody

SCOPe Domain Sequences for d5iwla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iwla1 b.1.1.0 (A:1-122) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgasvkvsckasgytftnynmhwvrqapgqrlewmgtiypgnddtsy
nqkfkdrvtitadtsastaymelsslrsedtavyycarggyramdywgqgtlvtvssggs
gg

SCOPe Domain Coordinates for d5iwla1:

Click to download the PDB-style file with coordinates for d5iwla1.
(The format of our PDB-style files is described here.)

Timeline for d5iwla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5iwla2