![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
![]() | Protein automated matches [190059] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries) |
![]() | Domain d5i4va_: 5i4v A: [319057] Other proteins in same PDB: d5i4vb2 automated match to d1p8da_ complexed with 67s |
PDB Entry: 5i4v (more details), 2.61 Å
SCOPe Domain Sequences for d5i4va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i4va_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpasgsasqqrfahftelaii svqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftysk ddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqq pyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiw dvhegsgsgshkilhrllqd
Timeline for d5i4va_:
![]() Domains from other chains: (mouse over for more information) d5i4vb1, d5i4vb2, d5i4ve1, d5i4vf_ |