SCOPe 2.08: Domain d5iida_: 5iid A:

Lineage for d5iida_ (5iid A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d5iida_: 5iid A: [319055]
   automated match to d3g0ja_
   complexed with 6bk

Details for d5iida_

PDB Entry: 5iid, 2.4 Å

PDB Description: crystal structure of the fifth bromodomain of human polybromo (pb1) in complex with 2-(3,4-dihydroxyphenyl)-5-hydroxy-4h-chromen-4-one

PDB Compounds: (A:) Protein polybromo-1

SCOPe Domain Sequences for d5iida_:

Sequence; same for both SEQRES and ATOM records:

>d5iida_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skymtpmqqklnevyeavknytdkrgrrlsaiflrlpsrselpdyyltikkpmdmekirs
hmmankyqdidsmvedfvmmfnnactynepesliykdalvlhkvlletrrdlegd

Timeline for d5iida_:

• d5iida_ first appeared in SCOPe 2.06
  
• d5iida_ appears in SCOPe 2.07