Lineage for d5h9qa_ (5h9q A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 2375328Species Human (Homo sapiens) [TaxId:9606] [187655] (101 PDB entries)
  8. 2375420Domain d5h9qa_: 5h9q A: [319051]
    automated match to d4xzpa_
    complexed with td2

Details for d5h9qa_

PDB Entry: 5h9q (more details), 1.93 Å

PDB Description: crystal structure of human galectin-7 in complex with td139
PDB Compounds: (A:) galectin-7

SCOPe Domain Sequences for d5h9qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h9qa_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msnvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsev
vfnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvr
lvevggdvqldsvrif

SCOPe Domain Coordinates for d5h9qa_:

Click to download the PDB-style file with coordinates for d5h9qa_.
(The format of our PDB-style files is described here.)

Timeline for d5h9qa_: