Lineage for d5cj9a2 (5cj9 A:79-149)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524493Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2524556Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) (S)
    forms trimers with three closely packed beta-sheets
  5. 2524598Family d.74.2.0: automated matches [194896] (1 protein)
    not a true family
  6. 2524599Protein automated matches [194897] (3 species)
    not a true protein
  7. 2524600Species Bacillus halodurans [TaxId:272558] [319040] (1 PDB entry)
  8. 2524601Domain d5cj9a2: 5cj9 A:79-149 [319041]
    Other proteins in same PDB: d5cj9a1, d5cj9a3
    automated match to d1b4ba_
    complexed with pgo

Details for d5cj9a2

PDB Entry: 5cj9 (more details), 2.41 Å

PDB Description: bacillus halodurans arginine repressor, argr
PDB Compounds: (A:) Arginine repressor

SCOPe Domain Sequences for d5cj9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cj9a2 d.74.2.0 (A:79-149) automated matches {Bacillus halodurans [TaxId: 272558]}
glvdsfvsidrtdnlivmktlpgnahaigalidnldwteimgticgddtiliickdkqdg
pvvterflnml

SCOPe Domain Coordinates for d5cj9a2:

Click to download the PDB-style file with coordinates for d5cj9a2.
(The format of our PDB-style files is described here.)

Timeline for d5cj9a2: