Lineage for d1e4vb1 (1e4v B:1-121,B:157-214)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123294Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2123299Protein Adenylate kinase [52554] (16 species)
  7. 2123323Species Escherichia coli [TaxId:562] [52560] (8 PDB entries)
    contains a rudiment "zinc-finger" subdomain, residue 122-156
  8. 2123327Domain d1e4vb1: 1e4v B:1-121,B:157-214 [31904]
    Other proteins in same PDB: d1e4va2, d1e4vb2
    complexed with ap5; mutant

Details for d1e4vb1

PDB Entry: 1e4v (more details), 1.85 Å

PDB Description: mutant g10v of adenylate kinase from e. coli, modified in the gly-loop
PDB Compounds: (B:) adenylate kinase

SCOPe Domain Sequences for d1e4vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4vb1 c.37.1.1 (B:1-121,B:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}
mriillgapvagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg

SCOPe Domain Coordinates for d1e4vb1:

Click to download the PDB-style file with coordinates for d1e4vb1.
(The format of our PDB-style files is described here.)

Timeline for d1e4vb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e4vb2