| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.3: Arginine repressor (ArgR), N-terminal DNA-binding domain [46792] (2 proteins) automatically mapped to Pfam PF01316 |
| Protein automated matches [319037] (1 species) not a true protein |
| Species Bacillus halodurans [TaxId:272558] [319038] (1 PDB entry) |
| Domain d5cj9a1: 5cj9 A:6-78 [319039] Other proteins in same PDB: d5cj9a2, d5cj9a3 automated match to d1b4aa1 complexed with pgo |
PDB Entry: 5cj9 (more details), 2.41 Å
SCOPe Domain Sequences for d5cj9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cj9a1 a.4.5.3 (A:6-78) automated matches {Bacillus halodurans [TaxId: 272558]}
rhikireiianndvetqdelveqlkaagynvtqatvsrdikelhlvkvpmmdgrykyslp
adqrfnplqklkr
Timeline for d5cj9a1: