Lineage for d5cj9a1 (5cj9 A:6-78)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2692979Family a.4.5.3: Arginine repressor (ArgR), N-terminal DNA-binding domain [46792] (2 proteins)
    automatically mapped to Pfam PF01316
  6. 2693002Protein automated matches [319037] (1 species)
    not a true protein
  7. 2693003Species Bacillus halodurans [TaxId:272558] [319038] (1 PDB entry)
  8. 2693004Domain d5cj9a1: 5cj9 A:6-78 [319039]
    Other proteins in same PDB: d5cj9a2, d5cj9a3
    automated match to d1b4aa1
    complexed with pgo

Details for d5cj9a1

PDB Entry: 5cj9 (more details), 2.41 Å

PDB Description: bacillus halodurans arginine repressor, argr
PDB Compounds: (A:) Arginine repressor

SCOPe Domain Sequences for d5cj9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cj9a1 a.4.5.3 (A:6-78) automated matches {Bacillus halodurans [TaxId: 272558]}
rhikireiianndvetqdelveqlkaagynvtqatvsrdikelhlvkvpmmdgrykyslp
adqrfnplqklkr

SCOPe Domain Coordinates for d5cj9a1:

Click to download the PDB-style file with coordinates for d5cj9a1.
(The format of our PDB-style files is described here.)

Timeline for d5cj9a1: