Lineage for d5fvbg_ (5fvb G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2689048Protein automated matches [190531] (23 species)
    not a true protein
  7. 2689141Species Phormidium rubidum [TaxId:865859] [272704] (5 PDB entries)
  8. 2689196Domain d5fvbg_: 5fvb G: [319034]
    automated match to d1eyxa_
    complexed with gol, peb

Details for d5fvbg_

PDB Entry: 5fvb (more details), 1.93 Å

PDB Description: crystal structure of phormidium c-phycoerythrin at ph 5.0
PDB Compounds: (G:) c-phycoerythrin alpha subunit

SCOPe Domain Sequences for d5fvbg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fvbg_ a.1.1.3 (G:) automated matches {Phormidium rubidum [TaxId: 865859]}
mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
glptapyvealsfarnrgcaprdmsaqalteynalldyainsls

SCOPe Domain Coordinates for d5fvbg_:

Click to download the PDB-style file with coordinates for d5fvbg_.
(The format of our PDB-style files is described here.)

Timeline for d5fvbg_: