SCOP 1.55: Domain d1e4yb1: 1e4y B:1-121,B:157-214

Lineage for d1e4yb1 (1e4y B:1-121,B:157-214)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families)

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (8 proteins)

6. Protein Adenylate kinase [52554] (8 species)

7. Species Escherichia coli [TaxId:562] [52560] (6 PDB entries)

8. Domain d1e4yb1: 1e4y B:1-121,B:157-214 [31902]
   Other proteins in same PDB: d1e4ya2, d1e4yb2

Details for d1e4yb1

PDB Entry: 1e4y, 1.85 Å

PDB Description: mutant p9l of adenylate kinase from e. coli, modified in the gly-loop

SCOP Domain Sequences for d1e4yb1:

Sequence; same for both SEQRES and ATOM records:

>d1e4yb1 c.37.1.1 (B:1-121,B:157-214) Adenylate kinase {Escherichia coli}
mriillgalvagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg

Timeline for d1e4yb1:

• d1e4yb1 appears in SCOP 1.57
  
• d1e4yb1 appears in the current release, SCOPe 2.08