SCOPe 2.08: Domain d1e4yb1: 1e4y B:1-121,B:157-214

Lineage for d1e4yb1 (1e4y B:1-121,B:157-214)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Adenylate kinase [52554] (16 species)

7. Species Escherichia coli [TaxId:562] [52560] (10 PDB entries)
   contains a rudiment "zinc-finger" subdomain, residue 122-156

8. Domain d1e4yb1: 1e4y B:1-121,B:157-214 [31902]
   Other proteins in same PDB: d1e4ya2, d1e4yb2
   complexed with ap5; mutant

Details for d1e4yb1

PDB Entry: 1e4y, 1.85 Å

PDB Description: mutant p9l of adenylate kinase from e. coli, modified in the gly-loop

PDB Compounds: (B:) adenylate kinase

SCOPe Domain Sequences for d1e4yb1:

Sequence; same for both SEQRES and ATOM records:

>d1e4yb1 c.37.1.1 (B:1-121,B:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}
mriillgalvagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg

Timeline for d1e4yb1:

• d1e4yb1 first appeared (with stable ids) in SCOP 1.55
  
• d1e4yb1 appears in SCOPe 2.07