Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Adenylate kinase [52554] (16 species) |
Species Escherichia coli [TaxId:562] [52560] (10 PDB entries) contains a rudiment "zinc-finger" subdomain, residue 122-156 |
Domain d1e4yb1: 1e4y B:1-121,B:157-214 [31902] Other proteins in same PDB: d1e4ya2, d1e4yb2 complexed with ap5; mutant |
PDB Entry: 1e4y (more details), 1.85 Å
SCOPe Domain Sequences for d1e4yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4yb1 c.37.1.1 (B:1-121,B:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} mriillgalvagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg
Timeline for d1e4yb1: