Class a: All alpha proteins [46456] (289 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries) |
Domain d5i4ve1: 5i4v E:218-459 [319016] Other proteins in same PDB: d5i4vb2 automated match to d1p8da_ complexed with 67s |
PDB Entry: 5i4v (more details), 2.61 Å
SCOPe Domain Sequences for d5i4ve1:
Sequence, based on SEQRES records: (download)
>d5i4ve1 a.123.1.1 (E:218-459) automated matches {Human (Homo sapiens) [TaxId: 9606]} vqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpasgsasqqrfahftelaii svqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftysk ddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqq pyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiw dv
>d5i4ve1 a.123.1.1 (E:218-459) automated matches {Human (Homo sapiens) [TaxId: 9606]} vqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgsasqqrfahftelaiisvqeiv dfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhra glqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveal lsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdv
Timeline for d5i4ve1:
View in 3D Domains from other chains: (mouse over for more information) d5i4va_, d5i4vb1, d5i4vb2, d5i4vf_ |