Lineage for d5i4ve1 (5i4v E:218-459)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein automated matches [190059] (14 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187214] (165 PDB entries)
  8. Domain d5i4ve1: 5i4v E:218-459 [319016]
    Other proteins in same PDB: d5i4vb2
    automated match to d1p8da_
    complexed with 67s

Details for d5i4ve1

PDB Entry: 5i4v (more details), 2.61 Å

PDB Description: discovery of novel, orally efficacious liver x receptor (lxr) beta agonists
PDB Compounds: (E:) Oxysterols receptor LXR-beta,Nuclear receptor coactivator 2

SCOPe Domain Sequences for d5i4ve1:

Sequence, based on SEQRES records: (download)

>d5i4ve1 a.123.1.1 (E:218-459) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpasgsasqqrfahftelaii
svqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftysk
ddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqq
pyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiw
dv

Sequence, based on observed residues (ATOM records): (download)

>d5i4ve1 a.123.1.1 (E:218-459) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgsasqqrfahftelaiisvqeiv
dfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhra
glqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveal
lsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdv

SCOPe Domain Coordinates for d5i4ve1 are not available.

Timeline for d5i4ve1:

Domains from other chains:
(mouse over for more information)
d5i4va_, d5i4vb1, d5i4vb2, d5i4vf_