Lineage for d1e4ya1 (1e4y A:1-121,A:157-214)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 483671Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (17 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 483672Protein Adenylate kinase [52554] (13 species)
  7. 483708Species Escherichia coli [TaxId:562] [52560] (6 PDB entries)
    contains a rudiment "zinc-finger" subdomain, residue 122-156
  8. 483709Domain d1e4ya1: 1e4y A:1-121,A:157-214 [31901]
    Other proteins in same PDB: d1e4ya2, d1e4yb2

Details for d1e4ya1

PDB Entry: 1e4y (more details), 1.85 Å

PDB Description: mutant p9l of adenylate kinase from e. coli, modified in the gly-loop

SCOP Domain Sequences for d1e4ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4ya1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli}
mriillgalvagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg

SCOP Domain Coordinates for d1e4ya1:

Click to download the PDB-style file with coordinates for d1e4ya1.
(The format of our PDB-style files is described here.)

Timeline for d1e4ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e4ya2