Lineage for d5c3ma1 (5c3m A:5-172)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846913Species Geobacillus stearothermophilus [TaxId:1422] [225639] (6 PDB entries)
  8. 2846930Domain d5c3ma1: 5c3m A:5-172 [319003]
    Other proteins in same PDB: d5c3ma2, d5c3mb2, d5c3mc2, d5c3md2
    automated match to d1s6ya1
    complexed with mn

Details for d5c3ma1

PDB Entry: 5c3m (more details), 3.06 Å

PDB Description: crystal structure of gan4c, a gh4 6-phospho-glucosidase from geobacillus stearothermophilus
PDB Compounds: (A:) Putative 6-phospho-beta-glucosidase

SCOPe Domain Sequences for d5c3ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c3ma1 c.2.1.0 (A:5-172) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
lkmatigggssytpelveglikryhelpvgelwlvdipegkekleivgalakrmvekagv
pieihltldrrralegadfvttqfrvgglearakderiplkygvigqetngpgglfkglr
tipvildiirdmeelcpdawlinftnpagmvteavlrytkqekvvglc

SCOPe Domain Coordinates for d5c3ma1:

Click to download the PDB-style file with coordinates for d5c3ma1.
(The format of our PDB-style files is described here.)

Timeline for d5c3ma1: