Lineage for d5ebuc_ (5ebu C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2414849Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2415386Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2415387Protein automated matches [190048] (22 species)
    not a true protein
  7. 2415388Species Aerococcus viridans [TaxId:1377] [187639] (8 PDB entries)
  8. 2415419Domain d5ebuc_: 5ebu C: [319000]
    automated match to d2du2a_
    complexed with fmn, pyr; mutant

Details for d5ebuc_

PDB Entry: 5ebu (more details), 2.6 Å

PDB Description: aerococcus viridans l-lactate oxidase y215f mutant
PDB Compounds: (C:) L-lactate oxidase

SCOPe Domain Sequences for d5ebuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ebuc_ c.1.4.0 (C:) automated matches {Aerococcus viridans [TaxId: 1377]}
ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl
aqdveapdtsteilghkikapfimapiaahglahatkeagtaravsefgtimsisaysga
tfeeiseglnggprwfqiymakddqqnrdildeakgdgataiiltadstvsgnrdrdvkn
kfvypfgmpivqrylrgtaegmslnnifgaskqkisprdieeiaahsglpvfvkgiqhpe
dadmaikagasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvak
alasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfd
npygyey

SCOPe Domain Coordinates for d5ebuc_:

Click to download the PDB-style file with coordinates for d5ebuc_.
(The format of our PDB-style files is described here.)

Timeline for d5ebuc_: