Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein automated matches [190531] (23 species) not a true protein |
Species Phormidium rubidum [TaxId:865859] [272704] (5 PDB entries) |
Domain d5fvbp_: 5fvb P: [318987] automated match to d3v57b_ complexed with gol, peb |
PDB Entry: 5fvb (more details), 1.93 Å
SCOPe Domain Sequences for d5fvbp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fvbp_ a.1.1.3 (P:) automated matches {Phormidium rubidum [TaxId: 865859]} mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi sals
Timeline for d5fvbp_: