Lineage for d3aky_1 (3aky 3-130,169-220)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393333Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (16 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 393334Protein Adenylate kinase [52554] (13 species)
  7. 393358Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52559] (4 PDB entries)
    contains a rudiment "zinc-finger" subdomain, residue 131-168
  8. 393361Domain d3aky_1: 3aky 3-130,169-220 [31898]
    Other proteins in same PDB: d3aky_2
    complexed with ap5, imd; mutant

Details for d3aky_1

PDB Entry: 3aky (more details), 2.23 Å

PDB Description: stability, activity and structure of adenylate kinase mutants

SCOP Domain Sequences for d3aky_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aky_1 c.37.1.1 (3-130,169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae)}
esirmvligppgagkgtqapnlqerfhaahlatgdmlrsqiakgtqlgleakkimdqggl
vsddimvnmikdeltnnpackngfildgfprtipqaekldqmlkeqgtplekaielkvdd
ellvaritXnadalkkrlaayhaqtepivdfykktgiwagvdasqppatvwadflnklgk
n

SCOP Domain Coordinates for d3aky_1:

Click to download the PDB-style file with coordinates for d3aky_1.
(The format of our PDB-style files is described here.)

Timeline for d3aky_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3aky_2