![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
![]() | Protein automated matches [190230] (23 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [318905] (2 PDB entries) |
![]() | Domain d5chtb_: 5cht B: [318978] Other proteins in same PDB: d5chta2 automated match to d2ibia1 complexed with zn |
PDB Entry: 5cht (more details), 2.8 Å
SCOPe Domain Sequences for d5chtb_:
Sequence, based on SEQRES records: (download)
>d5chtb_ d.3.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} phglvglhnigqtcclnsllqvfmmnmdfrmilkritvprsaeerkrsvpfqlllllekm qdsrqkavlptelvqclqkynvplfvqhdaaqlyltiwnltkdqitdtdlterlqglfti wtqeslicvgctaessrrsklltlslplfdkdakplktledalrcfvqpkelassdmcce scgektpwkqvlklthlpqtltihlmrfsarnsrtekichsvnfpqsldfsqvlpteedl gdtkeqseihyelfaviahvgmadfghycayirnpvdgkwfcfndshvcwvtwkdvqcty gnhryrwretayllvytkt
>d5chtb_ d.3.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} phglvglhnigqtcclnsllqvfmmnmdfrmilkritvprsaeerkrsvpfqlllllekm qdsrqkavlptelvqclqkynvplfvqhdaaqlyltiwnltkdqitdtdlterlqglfti wtqeslicvgctaessrrsklltlslplfdkdakplktledalrcfvqpkelassdmcce scgektpwkqvlklthlpqtltihlmrfstekichsvnfpqsldfsqveihyelfaviah vgmadfghycayirnpvdgkwfcfndshvcwvtwkdvqctygnhryrwretayllvytkt
Timeline for d5chtb_: