Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
Protein automated matches [190561] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries) |
Domain d5ehra1: 5ehr A:4-110 [318972] Other proteins in same PDB: d5ehra3, d5ehrb3 automated match to d2shpa2 complexed with 5od, po4 |
PDB Entry: 5ehr (more details), 1.7 Å
SCOPe Domain Sequences for d5ehra1:
Sequence, based on SEQRES records: (download)
>d5ehra1 d.93.1.0 (A:4-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy dlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse
>d5ehra1 d.93.1.0 (A:4-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdyy dlyggekfatlaelvqyymehielkyplncadptse
Timeline for d5ehra1: