Lineage for d5fvbs_ (5fvb S:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1979008Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1979193Protein automated matches [190531] (18 species)
    not a true protein
  7. 1979280Species Phormidium rubidum [TaxId:865859] [272704] (5 PDB entries)
  8. 1979347Domain d5fvbs_: 5fvb S: [318969]
    automated match to d3v57b_
    complexed with gol, peb

Details for d5fvbs_

PDB Entry: 5fvb (more details), 1.93 Å

PDB Description: crystal structure of phormidium c-phycoerythrin at ph 5.0
PDB Compounds: (S:) c-phycoerythrin beta subunit

SCOPe Domain Sequences for d5fvbs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fvbs_ a.1.1.3 (S:) automated matches {Phormidium rubidum [TaxId: 865859]}
mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
sals

SCOPe Domain Coordinates for d5fvbs_:

Click to download the PDB-style file with coordinates for d5fvbs_.
(The format of our PDB-style files is described here.)

Timeline for d5fvbs_: