Lineage for d5a4ua1 (5a4u A:2-86)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484529Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2485233Protein automated matches [227019] (4 species)
    not a true protein
  7. 2485253Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [318873] (4 PDB entries)
  8. 2485254Domain d5a4ua1: 5a4u A:2-86 [318967]
    Other proteins in same PDB: d5a4ua2, d5a4ub2, d5a4uc2, d5a4ud2, d5a4ue2, d5a4uf2
    automated match to d1gnwa2
    complexed with act, i3a

Details for d5a4ua1

PDB Entry: 5a4u (more details), 2 Å

PDB Description: atgstf2 from arabidopsis thaliana in complex with indole-3-aldehyde
PDB Compounds: (A:) glutathione s-transferase f2

SCOPe Domain Sequences for d5a4ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a4ua1 c.47.1.5 (A:2-86) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
agikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedg
dlklfesraitqyiahryenqgtnl

SCOPe Domain Coordinates for d5a4ua1:

Click to download the PDB-style file with coordinates for d5a4ua1.
(The format of our PDB-style files is described here.)

Timeline for d5a4ua1: