![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (18 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein Adenylate kinase [52554] (14 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52559] (4 PDB entries) contains a rudiment "zinc-finger" subdomain, residue 131-168 |
![]() | Domain d1aky_1: 1aky 3-130,169-220 [31896] Other proteins in same PDB: d1aky_2 complexed with ap5, imd |
PDB Entry: 1aky (more details), 1.63 Å
SCOP Domain Sequences for d1aky_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aky_1 c.37.1.1 (3-130,169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae)} esirmvligppgagkgtqapnlqerfhaahlatgdmlrsqiakgtqlgleakkimdqggl vsddimvnmikdeltnnpackngfildgfprtipqaekldqmlkeqgtplekaielkvdd ellvaritXnadalkkrlaayhaqtepivdfykktgiwagvdasqppatvwadilnklgk n
Timeline for d1aky_1: