![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (19 species) not a true protein |
![]() | Species Fungus (Aspergillus oryzae) [TaxId:5062] [318527] (2 PDB entries) |
![]() | Domain d5c71c2: 5c71 C:181-275 [318957] Other proteins in same PDB: d5c71a1, d5c71a3, d5c71b1, d5c71b3, d5c71c1, d5c71c3, d5c71d1, d5c71d3 automated match to d5czkb2 complexed with cbw, gcu |
PDB Entry: 5c71 (more details), 2.62 Å
SCOPe Domain Sequences for d5c71c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c71c2 b.1.4.0 (C:181-275) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]} qhiqditvrtdvqgttglidynvvasttqgtiqvavidedgttvatssgsngtihipsvh lwqpgaaylyqlhasiidsskktidtyklatgirt
Timeline for d5c71c2: