![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Fungus (Aspergillus oryzae) [TaxId:5062] [256310] (3 PDB entries) |
![]() | Domain d5c71c1: 5c71 C:1-180 [318956] Other proteins in same PDB: d5c71a2, d5c71a3, d5c71b2, d5c71b3, d5c71c2, d5c71c3, d5c71d2, d5c71d3 automated match to d5czkb1 complexed with cbw, gcu |
PDB Entry: 5c71 (more details), 2.62 Å
SCOPe Domain Sequences for d5c71c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c71c1 b.18.1.0 (C:1-180) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]} mlkpqqtttrdlisldglwkfalasddnntqpwtsqlktslecpvpasyndifadskihd hvgwvyyqrdvivpkgwseerylvrceaathhgriyvngnlvadhvggytpfeaditdlv aageqfrltiavdneltyqtippgkveileatgkkvqtyqhdfynyaglarsvwlysvpq
Timeline for d5c71c1: