Lineage for d2ak2a1 (2ak2 A:14-146,A:177-233)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845074Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1845079Protein Adenylate kinase [52554] (16 species)
  7. 1845094Species Cow (Bos taurus), mitochondrial izozyme-2 [TaxId:9913] [52558] (2 PDB entries)
    contains a rudiment "zinc-finger" subdomain, residue 147-176
  8. 1845096Domain d2ak2a1: 2ak2 A:14-146,A:177-233 [31895]
    Other proteins in same PDB: d2ak2a2
    complexed with so4

Details for d2ak2a1

PDB Entry: 2ak2 (more details), 2.1 Å

PDB Description: adenylate kinase isoenzyme-2
PDB Compounds: (A:) adenylate kinase isoenzyme-2

SCOPe Domain Sequences for d2ak2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}
pkgvravllgppgagkgtqapklaknfcvchlatgdmlramvasgselgkklkatmdagk
lvsdemvlelieknletppckngflldgfprtvrqaemlddlmekrkekldsviefsipd
sllirritgrlihXsddnkkalkirleayhtqttplveyyskrgihsaidasqtpdvvfa
silaafskats

SCOPe Domain Coordinates for d2ak2a1:

Click to download the PDB-style file with coordinates for d2ak2a1.
(The format of our PDB-style files is described here.)

Timeline for d2ak2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ak2a2