Lineage for d2ak2_1 (2ak2 14-146,177-233)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins) 
Protein Adenylate kinase [52554] (8 species) 
Species Cow (Bos taurus), mitochondrial izozyme-2 [TaxId:9913] [52558] (2 PDB entries) 
Domain d2ak2_1: 2ak2 14-146,177-233 [31895]
Other proteins in same PDB: d2ak2_2
Details for d2ak2_1
PDB Entry: 2ak2 (more details), 2.1 Å
PDB Description: adenylate kinase isoenzyme-2
SCOP Domain Sequences for d2ak2_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ak2_1 c.37.1.1 (14-146,177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2}
pkgvravllgppgagkgtqapklaknfcvchlatgdmlramvasgselgkklkatmdagk
lvsdemvlelieknletppckngflldgfprtvrqaemlddlmekrkekldsviefsipd
sllirritgrlihXsddnkkalkirleayhtqttplveyyskrgihsaidasqtpdvvfa
silaafskats
SCOP Domain Coordinates for d2ak2_1:
Click to download the PDB-style file with coordinates for d2ak2_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ak2_1:
- d2ak2_1 first appeared (with stable ids) in SCOP 1.55
- d2ak2_1 appears in SCOP 1.59
- d2ak2_1 appears in SCOP 1.63
- d2ak2_1 appears in the current release, SCOPe 2.08, called d2ak2a1
View in 3D
