Lineage for d1ak2a1 (1ak2 A:14-146,A:177-233)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829352Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 829357Protein Adenylate kinase [52554] (14 species)
  7. 829387Species Cow (Bos taurus), mitochondrial izozyme-2 [TaxId:9913] [52558] (2 PDB entries)
    contains a rudiment "zinc-finger" subdomain, residue 147-176
  8. 829388Domain d1ak2a1: 1ak2 A:14-146,A:177-233 [31894]
    Other proteins in same PDB: d1ak2a2
    complexed with so4

Details for d1ak2a1

PDB Entry: 1ak2 (more details), 1.92 Å

PDB Description: adenylate kinase isoenzyme-2
PDB Compounds: (A:) adenylate kinase isoenzyme-2

SCOP Domain Sequences for d1ak2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}
pkgvravllgppgagkgtqapklaknfcvchlatgdmlramvasgselgkklkatmdagk
lvsdemvlelieknletppckngflldgfprtvrqaemlddlmekrkekldsviefsipd
sllirritgrlihXsddnkkalkirleayhtqttplveyyskrgihsaidasqtpdvvfa
silaafskats

SCOP Domain Coordinates for d1ak2a1:

Click to download the PDB-style file with coordinates for d1ak2a1.
(The format of our PDB-style files is described here.)

Timeline for d1ak2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ak2a2