Lineage for d1ak2_1 (1ak2 14-146,177-233)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121669Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (12 proteins)
  6. 121670Protein Adenylate kinase [52554] (8 species)
  7. 121688Species Cow (Bos taurus), mitochondrial izozyme-2 [TaxId:9913] [52558] (2 PDB entries)
  8. 121689Domain d1ak2_1: 1ak2 14-146,177-233 [31894]
    Other proteins in same PDB: d1ak2_2

Details for d1ak2_1

PDB Entry: 1ak2 (more details), 1.92 Å

PDB Description: adenylate kinase isoenzyme-2

SCOP Domain Sequences for d1ak2_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ak2_1 c.37.1.1 (14-146,177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2}
pkgvravllgppgagkgtqapklaknfcvchlatgdmlramvasgselgkklkatmdagk
lvsdemvlelieknletppckngflldgfprtvrqaemlddlmekrkekldsviefsipd
sllirritgrlihXsddnkkalkirleayhtqttplveyyskrgihsaidasqtpdvvfa
silaafskats

SCOP Domain Coordinates for d1ak2_1:

Click to download the PDB-style file with coordinates for d1ak2_1.
(The format of our PDB-style files is described here.)

Timeline for d1ak2_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ak2_2